PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_6DL_77ACE1279.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family bZIP
Protein Properties Length: 197aa    MW: 22136.7 Da    PI: 7.0171
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_6DL_77ACE1279.2genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_140.27.2e-13104163463
                            XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                 bZIP_1   4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                             +r rr+ +NRe+ArrsR RK++++ eL   v  L + N++L ++l++    ++++  ++
  Traes_6DL_77ACE1279.2 104 ERRRRRMVSNRESARRSRMRKQKQLSELWAQVVHLRGANRQLLDQLNRVIRDCDRVLRDN 163
                            5899*******************************************9999998876665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003387.8E-13101165IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1702.2E-9102158No hitNo description
PfamPF001703.6E-10103160IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.358103166IPR004827Basic-leucine zipper domain
SuperFamilySSF579596.84E-11105154No hitNo description
PROSITE patternPS000360108123IPR004827Basic-leucine zipper domain
CDDcd147028.03E-15110157No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 197 aa     Download sequence    Send to blast
MYPAELASVP YLSAATATAA FRPHYQVAPD DFLFQYNGGG LLVPQAATSP CSSYQQHDVA  60
GQLLHEAASA GGLLLPFGAR SSNSDESDEY HHHHQAAHCS LAEERRRRRM VSNRESARRS  120
RMRKQKQLSE LWAQVVHLRG ANRQLLDQLN RVIRDCDRVL RDNSSLRAEQ AELRERLEKL  180
PVPVAVAVED AEEEEGR
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1104125RRRRRMVSNRESARRSRMRKQK
2117124RRSRMRKQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00647PBMTransfer from LOC_Os02g49560Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9667392e-46EU966739.1 Zea mays clone 296875 G-box-binding factor 1 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003570460.13e-73PREDICTED: basic leucine zipper 43-like
TrEMBLW5GXB31e-142W5GXB3_WHEAT; Uncharacterized protein
STRINGBRADI3G56290.19e-73(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP118635126
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G30530.18e-11basic leucine-zipper 42
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]